Visual Effects Supervisors Grady Cofer and Pablo Helman Talk about BATTLESHIP, Turning Pegs into Weapons, Sinking a Battleship, and More

by     Posted: August 21st, 2012 at 12:16 pm

battleship-interview-visual-effects-supervisors-interview-slice

Earlier this summer, Universal invited us to go to Industrial Light & Magic, the effects studio behind Star Wars, Indiana Jones, and other classic blockbusters.  With the upcoming release of Battleship on Blu-ray, we spoke with visual effects supervisors Grady Cofer and Pablo Helman.  When we look at visual effects, we tend to notice the in-your-face stuff, but the true magic is in effects you never see or immediately think about: the water droplets, the weight of objects, etc.  This is fascinating stuff, and in my interview with Cofer and Helman, we spoke about the challenges of animating water, how they translated the board game pegs into weapons, the sinking of the USS John Paul Jones, creating the shredder, and more.

Hit the jump to check out the interview.  Battleship hits Blu-ray, DVD, and Digital Download on August 28th.

Grady Cofer and Pablo Helman

  • 0:15 – Cofer and Helman explain their jobs on the film.
  • 1:38 – Taking the pegs from the board game and translating them to a visual effect.
  • 3:03 – What were the challenges of animating water in Battleship as opposed to other films featuring water?
  • 4:43 – A particularly memorable challenge in the two-minute sequence of sinking the USS John Paul Jones.
  • 6:27 – How do they create the shredder when it has no basis in reality?





battleship-blu-ray-box-cover-art




Please Like Collider on Facebook

Comments:
  • Zswick

    Sure, this movie isn’t great but it has some of the best visuals I’ve ever seen. I was so pleasantly surprised by it all. Made me feel like a kid again.

  • Lance

    I don’t usually call people out for being plants, but in the case of Battleship…

  • http://trickphotographyandspecialeffectsreviews.com trickphotographyandspecialeffectsreviews.com

    Hi there, I enjoy reading through your article post.
    I wanted to write a little comment to support you.

Features

IndieClick Film Network

Click Here